PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.3DJ3B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 184aa    MW: 20962.7 Da    PI: 9.9754
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.3DJ3BgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.7e-12115158347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       WT +E++l++++ ++lG+  W++I+++  k+R+  q++s+ qk+
      Aradu.3DJ3B 115 HWTLQEHKLFLQGYEELGKQ-WSKISSEYVKTRSYSQIVSHSQKF 158
                      6*****************99.********************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.917108163IPR017930Myb domain
SuperFamilySSF466892.57E-12109164IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-10112162IPR006447Myb domain, plants
SMARTSM007173.3E-7112161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-7115154IPR009057Homeodomain-like
PfamPF002494.5E-9115157IPR001005SANT/Myb domain
CDDcd001679.49E-6116154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MTDVNAIKNG NPENMNIMIP LPATSLEHSL LSIPVVNATP PPPPPPPHWT HHQHHRMEVM  60
APAADMPVPM HITLLSSSMS GARREQNQHA NSNIIQHEPL HAASSNNNKR QQTVHWTLQE  120
HKLFLQGYEE LGKQWSKISS EYVKTRSYSQ IVSHSQKFFK RQEKRARGEN LGRKSMLDIT  180
DYST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015947385.11e-124PREDICTED: transcription factor MYB1R1-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.17e-16MYB_related family protein